CDS

Accession Number TCMCG005C13770
gbkey CDS
Protein Id XP_020259537.1
Location join(69508397..69508630,69508727..69508840)
Gene LOC109836002
GeneID 109836002
Organism Asparagus officinalis

Protein

Length 115aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA376608;
db_source XM_020403948.1
Definition elongation factor G, mitochondrial-like

EGGNOG-MAPPER Annotation

COG_category J
Description Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A- site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03012        [VIEW IN KEGG]
ko03029        [VIEW IN KEGG]
KEGG_ko ko:K02355        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000166        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0003746        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0003924        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005524        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0006412        [VIEW IN EMBL-EBI]
GO:0006414        [VIEW IN EMBL-EBI]
GO:0006518        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008135        [VIEW IN EMBL-EBI]
GO:0008144        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009059        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010035        [VIEW IN EMBL-EBI]
GO:0010038        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0016462        [VIEW IN EMBL-EBI]
GO:0016787        [VIEW IN EMBL-EBI]
GO:0016817        [VIEW IN EMBL-EBI]
GO:0016818        [VIEW IN EMBL-EBI]
GO:0017076        [VIEW IN EMBL-EBI]
GO:0017111        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0030554        [VIEW IN EMBL-EBI]
GO:0032543        [VIEW IN EMBL-EBI]
GO:0032553        [VIEW IN EMBL-EBI]
GO:0032555        [VIEW IN EMBL-EBI]
GO:0032559        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0034645        [VIEW IN EMBL-EBI]
GO:0035639        [VIEW IN EMBL-EBI]
GO:0036094        [VIEW IN EMBL-EBI]
GO:0042221        [VIEW IN EMBL-EBI]
GO:0043043        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043168        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043603        [VIEW IN EMBL-EBI]
GO:0043604        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044271        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046686        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0070125        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0097367        [VIEW IN EMBL-EBI]
GO:0140053        [VIEW IN EMBL-EBI]
GO:1901265        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGTGGAAGGAGGCGATGGAGAAGATGAGAAACATCGGGATCTCGTCTACATCGACTCGGGGAAGACGACGCTCACCAAGAGGATACTCTTCTACACTGGCAGAGTCCATGAGATCCACAAGGTGAGGGTGAGAGATGGAGTTGGGGCGAAGATGGATTCGATGGATTTGGAGAGGGAGAGGGGGATCACGATTCAGTCCGCTGCTACTTACTGCACGTGGAATGGGTATCAGCATTTTCCCAATACTTACAGGTTCTCGCAATTGAGTTCTGTTCTCGATCCTGATAAGCCTCCAAGGTCTGATAAAGTAAGTATTTTAGGTGATGCCGCTCGCCTGCTGATGTAG
Protein:  
MVEGGDGEDEKHRDLVYIDSGKTTLTKRILFYTGRVHEIHKVRVRDGVGAKMDSMDLERERGITIQSAATYCTWNGYQHFPNTYRFSQLSSVLDPDKPPRSDKVSILGDAARLLM